Please use this identifier to cite or link to this item: https://hdl.handle.net/10356/84025
Title: Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides
Authors: Braun, Katharina
Pochert, Alexander
Lindén, Mika
Davoudi, Mina
Schmidtchen, Artur
Nordström, Randi
Malmsten, Martin
Keywords: membrane
antimicrobial peptides
Issue Date: 2016
Source: Braun, K., Pochert, A., Lindén, M., Davoudi, M., Schmidtchen, A., Nordström, R., et al. (2016). Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides. Journal of Colloid and Interface Science, 475, 161-170.
Series/Report no.: Journal of Colloid and Interface Science
Abstract: Membrane interactions are critical for the successful use of mesoporous silica nanoparticles as delivery systems for antimicrobial peptides (AMPs). In order to elucidate these, we here investigate effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects. Anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles. Due to preferential pore localization, anionic mesoporous particles, but not the other particles, protect LL-37 from degradation by infection-related proteases. For anionic mesoporous nanoparticles, membrane disruption is mediated almost exclusively by peptide release. In contrast, non-porous silica particles build up a resilient LL-37 surface coating due to their higher negative surface charge, and display largely particle-mediated membrane interactions and antimicrobial effects. For positively charged mesoporous silica nanoparticles, LL-37 incorporation promotes the membrane binding and disruption displayed by the particles in the absence of peptide, but also causes toxicity against human erythrocytes. Thus, the use of mesoporous silica nanoparticles as AMP delivery systems requires consideration of membrane interactions and selectivity of both free peptide and the peptide-loaded nanoparticles, the latter critically dependent on nanoparticle properties.
URI: https://hdl.handle.net/10356/84025
http://hdl.handle.net/10220/41593
ISSN: 0021-9797
DOI: 10.1016/j.jcis.2016.05.002
Rights: © 2016 Elsevier Inc. This is the author created version of a work that has been peer reviewed and accepted for publication by Journal of Colloid and Interface Science, Elsevier. It incorporates referee’s comments but changes resulting from the publishing process, such as copyediting, structural formatting, may not be reflected in this document. The published version is available at: [http://dx.doi.org/10.1016/j.jcis.2016.05.002].
Fulltext Permission: open
Fulltext Availability: With Fulltext
Appears in Collections:LKCMedicine Journal Articles

Google ScholarTM

Check

Altmetric

Items in DR-NTU are protected by copyright, with all rights reserved, unless otherwise indicated.